Recombinant Staphylococcus aureus Alpha-hemolysin (hly), Unconjugated, E. coli

Artikelnummer: BIM-RPC23073
Artikelname: Recombinant Staphylococcus aureus Alpha-hemolysin (hly), Unconjugated, E. coli
Artikelnummer: BIM-RPC23073
Hersteller Artikelnummer: RPC23073
Alternativnummer: BIM-RPC23073-20UG,BIM-RPC23073-100UG,BIM-RPC23073-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Alpha-toxin
Recombinant Staphylococcus aureus Alpha-hemolysin (hly) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain NCTC 8325). Target Name: hly. Target Synonyms: Alpha-toxin. Accession Number: Q2G1X0. Expression Region: 27~319aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD
Target-Kategorie: hly