Recombinant Bovine Pregnancy-associated glycoprotein 1, Unconjugated, E. coli

Artikelnummer: BIM-RPC23080
Artikelname: Recombinant Bovine Pregnancy-associated glycoprotein 1, Unconjugated, E. coli
Artikelnummer: BIM-RPC23080
Hersteller Artikelnummer: RPC23080
Alternativnummer: BIM-RPC23080-20UG,BIM-RPC23080-100UG,BIM-RPC23080-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: Pregnancy-specific protein BPSP-B
Recombinant Bovine Pregnancy-associated glycoprotein 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: Bovine Pregnancy-associated glycoprotein 1. Target Synonyms: Pregnancy-specific protein BPSP-B. Accession Number: Q29432. Expression Region: 54~380aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 40.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 40.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: RGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNT
Target-Kategorie: Bovine Pregnancy-associated glycoprotein 1