Recombinant Macaca fascicularis Gamma-synuclein (SNCG), Unconjugated, E. coli

Artikelnummer: BIM-RPC23081
Artikelname: Recombinant Macaca fascicularis Gamma-synuclein (SNCG), Unconjugated, E. coli
Artikelnummer: BIM-RPC23081
Hersteller Artikelnummer: RPC23081
Alternativnummer: BIM-RPC23081-20UG,BIM-RPC23081-100UG,BIM-RPC23081-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: SNCG, QflA-20719, Gamma-synuclein
Recombinant Macaca fascicularis Gamma-synuclein (SNCG) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Target Name: SNCG. Target Synonyms: SNCG, QflA-20719, Gamma-synuclein. Accession Number: Q2PFW6. Expression Region: 1~127aa. Tag Info: Tag-Free. Theoretical MW: 13.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 13.3kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD
Target-Kategorie: SNCG