Recombinant Mouse Allergin-1 (Milr1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23092
Artikelname: Recombinant Mouse Allergin-1 (Milr1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23092
Hersteller Artikelnummer: RPC23092
Alternativnummer: BIM-RPC23092-20UG,BIM-RPC23092-100UG,BIM-RPC23092-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Allergy inhibitory receptor 1Mast cell antigen 32MCA-32Mast cell Ag-32Mast cell immunoglobulin-like receptor 1Gm885, Mca32
Recombinant Mouse Allergin-1 (Milr1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Milr1. Target Synonyms: Allergy inhibitory receptor 1Mast cell antigen 32MCA-32Mast cell Ag-32Mast cell immunoglobulin-like receptor 1Gm885, Mca32. Accession Number: Q3TB92. Expression Region: 34~150aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 20.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS
Target-Kategorie: Milr1