Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx1/CMx3, Unconjugated, E. coli

Artikelnummer: BIM-RPC23106
Artikelname: Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx1/CMx3, Unconjugated, E. coli
Artikelnummer: BIM-RPC23106
Hersteller Artikelnummer: RPC23106
Alternativnummer: BIM-RPC23106-20UG,BIM-RPC23106-100UG,BIM-RPC23106-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: ITRL-1/ITRL-3
Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx1/CMx3 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Triticum aestivum (Wheat). Target Name: Triticum aestivum Trypsin/alpha-amylase inhibitor CMx1/CMx3. Target Synonyms: ITRL-1/ITRL-3. Accession Number: Q43723. Expression Region: 25~121aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.4kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKGSLLQDMSRCKKLTREFIAGIVGRE
Target-Kategorie: Triticum aestivum Trypsin/alpha-amylase inhibitor CMx1/CMx3