Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB), Unconjugated, E. coli

Artikelnummer: BIM-RPC23107
Artikelname: Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB), Unconjugated, E. coli
Artikelnummer: BIM-RPC23107
Hersteller Artikelnummer: RPC23107
Alternativnummer: BIM-RPC23107-20UG,BIM-RPC23107-100UG,BIM-RPC23107-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: dinB, CPS_1040DNA polymerase IV, Pol IV, EC 2.7.7.7
Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus). Target Name: dinB. Target Synonyms: dinB, CPS_1040DNA polymerase IV, Pol IV, EC 2.7.7.7. Accession Number: Q487H6. Expression Region: 1~352aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 43.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 43.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDI
Target-Kategorie: dinB