Recombinant Staphylococcus haemolyticus Dihydropteroate synthase (folP), Unconjugated, E. coli

Artikelnummer: BIM-RPC23110
Artikelname: Recombinant Staphylococcus haemolyticus Dihydropteroate synthase (folP), Unconjugated, E. coli
Artikelnummer: BIM-RPC23110
Hersteller Artikelnummer: RPC23110
Alternativnummer: BIM-RPC23110-20UG,BIM-RPC23110-100UG,BIM-RPC23110-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Dihydropteroate pyrophosphorylase
Recombinant Staphylococcus haemolyticus Dihydropteroate synthase (folP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus haemolyticus. Target Name: folP. Target Synonyms: Dihydropteroate pyrophosphorylase. Accession Number: Q59919. Expression Region: 1~267aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTKTKIIGILNVTPDSFSDGGKYNSVDKAIARAKEMIDEGVDIIDVGGVSTRPGHTEVSLEEEMERVVPVVEQLVKLDVQISVDTYRSEVAEACLKLGATMINDQWAGLYDPKIFDVVSDYNAEIVLMHNGDGQREQPVVEEMLLSLLTQANKAEMAGIEKGNIWLDPGIGFAKSRSEEKEVMARLDELVATEYPVLLATSRKRFIKEMIGKETTPAERDEATAATTVYGIMKGIQAVRVHNVDLNVKLAQSIDF
Target-Kategorie: folP