Recombinant Pseudomonas aeruginosa L-ornithine 5-monooxygenase (pvdA), Unconjugated, E. coli

Artikelnummer: BIM-RPC23127
Artikelname: Recombinant Pseudomonas aeruginosa L-ornithine 5-monooxygenase (pvdA), Unconjugated, E. coli
Artikelnummer: BIM-RPC23127
Hersteller Artikelnummer: RPC23127
Alternativnummer: BIM-RPC23127-20UG,BIM-RPC23127-100UG,BIM-RPC23127-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: L-ornithine N(5)-hydroxylaseL-ornithine N(5)-oxygenasePyoverdin biosynthesis protein A
Recombinant Pseudomonas aeruginosa L-ornithine 5-monooxygenase (pvdA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228). Target Name: pvdA. Target Synonyms: L-ornithine N(5)-hydroxylaseL-ornithine N(5)-oxygenasePyoverdin biosynthesis protein A. Accession Number: Q51548. Expression Region: 1~443aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 65.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 65.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTQATATAVVHDLIGVGFGPSNIALAIALQERAQAQGALEVLFLDKQGDYRWHGNTLVSQSELQISFLKDLVSLRNPTSPYSFVNYLHKHDRLVDFINLGTFYPCRMEFNDYLRWVASHFQEQSRYGEEVLRIEPMLSAGQVEALRVISRNADGEELVRTTRALVVSPGGTPRIPQVFRALKGDGRVFHHSQYLEHMAKQPCSSGKPMKIAIIGGGQSAAEAFIDLNDSYPSVQADMILRASALKPADDSPFVNE
Target-Kategorie: pvdA