Recombinant Human GDNF family receptor alpha-like (GFRAL), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23215
Artikelname: Recombinant Human GDNF family receptor alpha-like (GFRAL), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23215
Hersteller Artikelnummer: RPC23215
Alternativnummer: BIM-RPC23215-20UG,BIM-RPC23215-100UG,BIM-RPC23215-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: bA360D14.1, C6orf144, GDNF family receptor alpha-like, Gfral, GFRAL_HUMAN, GRAL, IVFI9356, UNQ9356, UNQ9356/PRO34128
Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GFRAL. Target Synonyms: bA360D14.1, C6orf144, GDNF family receptor alpha-like, Gfral, GFRAL_HUMAN, GRAL, IVFI9356, UNQ9356, UNQ9356/PRO34128. Accession Number: Q6UXV0. Expression Region: 19~351aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSD
Target-Kategorie: GFRAL