Recombinant Human Angiopoietin-like protein 8 (ANGPTL8), Unconjugated, E. coli

Artikelnummer: BIM-RPC23237
Artikelname: Recombinant Human Angiopoietin-like protein 8 (ANGPTL8), Unconjugated, E. coli
Artikelnummer: BIM-RPC23237
Hersteller Artikelnummer: RPC23237
Alternativnummer: BIM-RPC23237-20UG,BIM-RPC23237-100UG,BIM-RPC23237-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Betatrophin1
Recombinant Human Angiopoietin-like protein 8 (ANGPTL8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: C19orf80. Target Synonyms: Betatrophin1. Accession Number: Q6UXH0. Expression Region: 22~198aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 23.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Target-Kategorie: C19orf80