Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X), Unconjugated, E. coli

Artikelnummer: BIM-RPC23571
Artikelname: Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X), Unconjugated, E. coli
Artikelnummer: BIM-RPC23571
Hersteller Artikelnummer: RPC23571
Alternativnummer: BIM-RPC23571-20UG,BIM-RPC23571-100UG,BIM-RPC23571-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: HBxPeptide XpX
Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D). Target Name: X. Target Synonyms: HBxPeptide XpX. Accession Number: Q9QMI3. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Target-Kategorie: X