Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN), Unconjugated, E. coli

Artikelnummer: BIM-RPC23574
Artikelname: Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN), Unconjugated, E. coli
Artikelnummer: BIM-RPC23574
Hersteller Artikelnummer: RPC23574
Alternativnummer: BIM-RPC23574-20UG,BIM-RPC23574-100UG,BIM-RPC23574-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: FIL1 deltaIL-1-related protein 3, IL-1RP3Interleukin-1 HY1, IL-1HY1Interleukin-1 delta, IL-1 deltaInterleukin-1 family member 5, IL-1F5Interleukin-1 receptor antagonist homolog 1, IL-1ra homolog 1Interleukin-1-like protein 1, IL-1L1
Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IL36RN. Target Synonyms: FIL1 deltaIL-1-related protein 3, IL-1RP3Interleukin-1 HY1, IL-1HY1Interleukin-1 delta, IL-1 deltaInterleukin-1 family member 5, IL-1F5Interleukin-1 receptor antagonist homolog 1, IL-1ra homolog 1Interleukin-1-like protein 1, IL-1L1. Accession Number: Q9UBH0. Expression Region: 1~155aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Target-Kategorie: IL36RN