Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23647
Artikelname: Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23647
Hersteller Artikelnummer: RPC23647
Alternativnummer: BIM-RPC23647-20UG,BIM-RPC23647-100UG,BIM-RPC23647-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Damage-induced neuronal endopeptidaseXce proteinDine, Xce
Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ecel1. Target Synonyms: Damage-induced neuronal endopeptidaseXce proteinDine, Xce. Accession Number: Q9JMI0. Expression Region: 1~61aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 13.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 13.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC
Target-Kategorie: Ecel1