Recombinant Influenza A virus Polymerase acidic protein (PA), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC23675
Artikelname: Recombinant Influenza A virus Polymerase acidic protein (PA), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC23675
Hersteller Artikelnummer: RPC23675
Alternativnummer: BIM-RPC23675-20UG,BIM-RPC23675-100UG,BIM-RPC23675-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: RNA-directed RNA polymerase subunit P2
Recombinant Influenza A virus Polymerase acidic protein (PA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/x-31 H3N2). Target Name: PA. Target Synonyms: RNA-directed RNA polymerase subunit P2. Accession Number: Q9IQ47. Expression Region: 124~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS
Target-Kategorie: PA