Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3), Unconjugated, E. coli

Artikelnummer: BIM-RPC23694
Artikelname: Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3), Unconjugated, E. coli
Artikelnummer: BIM-RPC23694
Hersteller Artikelnummer: RPC23694
Alternativnummer: BIM-RPC23694-20UG,BIM-RPC23694-100UG,BIM-RPC23694-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Collagenous repeat-containing sequence 26 kDa protein, CORS26Secretory protein CORS26
Accession Number: Q9BXJ4. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 23~246aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Metabolism. Shipping Condition: Ice packs. Short Description: Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3) is a purified Recombinant Protein
Molekulargewicht: 28.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Target-Kategorie: C1QTNF3