Recombinant Human N-myc proto-oncogene protein (MYCN), Unconjugated, Yeast

Artikelnummer: BIM-RPC24839
Artikelname: Recombinant Human N-myc proto-oncogene protein (MYCN), Unconjugated, Yeast
Artikelnummer: BIM-RPC24839
Hersteller Artikelnummer: RPC24839
Alternativnummer: BIM-RPC24839-20UG,BIM-RPC24839-100UG,BIM-RPC24839-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Class E basic helix-loop-helix protein 37, bHLHe37
Accession Number: P04198. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1~464aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human N-myc proto-oncogene protein (MYCN) is a purified Recombinant Protein
Molekulargewicht: 51.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALST
Target-Kategorie: MYCN