Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD), Unconjugated, Yeast

Artikelnummer: BIM-RPC25474
Artikelname: Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD), Unconjugated, Yeast
Artikelnummer: BIM-RPC25474
Hersteller Artikelnummer: RPC25474
Alternativnummer: BIM-RPC25474-20UG,BIM-RPC25474-100UG,BIM-RPC25474-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Carboxymethylcellulase DCellulase 61ACellulase Dcel61A
Recombinant Aspergillus kawachii Probable endo-beta-1, 4-glucanase D (eglD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aspergillus kawachii (strain NBRC 4308). Target Name: eglD. Target Synonyms: Carboxymethylcellulase DCellulase 61ACellulase Dcel61A. Accession Number: Q96WQ9. Expression Region: 21~408aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 55.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.7kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAV
Target-Kategorie: eglD