Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25477
Artikelname: Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25477
Hersteller Artikelnummer: RPC25477
Alternativnummer: BIM-RPC25477-20UG,BIM-RPC25477-100UG,BIM-RPC25477-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DOCK8Dedicator of cytokinesis protein 8
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DOCK8. Target Synonyms: DOCK8Dedicator of cytokinesis protein 8. Accession Number: Q8NF50. Expression Region: 560~729aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Target-Kategorie: DOCK8