Recombinant Human Fatty acid synthase (FASN), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25596
Artikelname: Recombinant Human Fatty acid synthase (FASN), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25596
Hersteller Artikelnummer: RPC25596
Alternativnummer: BIM-RPC25596-20UG,BIM-RPC25596-100UG,BIM-RPC25596-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: [Acyl-carrier-protein] S acetyltransferase, [Acyl-carrier-protein] S malonyltransferase, 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase, 3-oxoacyl-[acyl-carrier-protein] reductase, 3-oxoacyl-[acyl-carrier-protein] synthase, Enoyl-[acyl-carrier-protein] reductase, FAS, FAS_HUMAN, FASN, Fatty acid synthase, MGC14367, MGC15706, OA 519, Oleoyl-[acyl-carrier-protein] hydrolase, SDR27X1, Short chain dehydrogenase/reductase family 27X member 1
Recombinant Human Fatty acid synthase (FASN), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FASN FAS. Target Synonyms: [Acyl-carrier-protein] S acetyltransferase, [Acyl-carrier-protein] S malonyltransferase, 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase. Accession Number: P49327. Expression Region: 2155~2495aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQ
Target-Kategorie: FASN FAS