Recombinant Human Metallothionein-1X (MT1X), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25598
Artikelname: Recombinant Human Metallothionein-1X (MT1X), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25598
Hersteller Artikelnummer: RPC25598
Alternativnummer: BIM-RPC25598-20UG,BIM-RPC25598-100UG,BIM-RPC25598-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Metallothionein-IX, MT-IX
Recombinant Human Metallothionein-1X (MT1X), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MT1X. Target Synonyms: Metallothionein-IX, MT-IX. Accession Number: P80297. Expression Region: 1~59aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 32.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.9kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Target-Kategorie: MT1X