Recombinant Rat Protein S100-A4 (S100a4), Unconjugated, E. coli

Artikelnummer: BIM-RPC25708
Artikelname: Recombinant Rat Protein S100-A4 (S100a4), Unconjugated, E. coli
Artikelnummer: BIM-RPC25708
Hersteller Artikelnummer: RPC25708
Alternativnummer: BIM-RPC25708-20UG,BIM-RPC25708-100UG,BIM-RPC25708-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Metastasin (Nerve growth factor-induced protein 42A, P9K, Placental calcium-binding protein, S100 calcium-binding protein A4)
Recombinant Rat Protein S100-A4 (S100a4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: S100a4. Target Synonyms: Metastasin (Nerve growth factor-induced protein 42A, P9K, Placental calcium-binding protein, S100 calcium-binding protein A4). Accession Number: P05942. Expression Region: 2~101aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Target-Kategorie: S100a4