Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25715
Artikelname: Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25715
Hersteller Artikelnummer: RPC25715
Alternativnummer: BIM-RPC25715-20UG,BIM-RPC25715-100UG,BIM-RPC25715-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Virion membrane protein M25
Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Target Name: VACWR088. Target Synonyms: Virion membrane protein M25. Accession Number: P07612. Expression Region: 2~183aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
Target-Kategorie: VACWR088