Recombinant Human Trefoil factor 3 (TFF3), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25717
Artikelname: Recombinant Human Trefoil factor 3 (TFF3), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25717
Hersteller Artikelnummer: RPC25717
Alternativnummer: BIM-RPC25717-20UG,BIM-RPC25717-100UG,BIM-RPC25717-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Intestinal trefoil factor (hITF, Polypeptide P1.B, hP1.B, ITF, TFI)
Recombinant Human Trefoil factor 3 (TFF3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TFF3. Target Synonyms: Intestinal trefoil factor (hITF, Polypeptide P1.B, hP1.B, ITF, TFI). Accession Number: Q07654. Expression Region: 29~80aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 7.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 7.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Target-Kategorie: TFF3