Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated, Unconjugated, E. coli

Artikelnummer: BIM-RPC27187
Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated, Unconjugated, E. coli
Artikelnummer: BIM-RPC27187
Hersteller Artikelnummer: RPC27187
Alternativnummer: BIM-RPC27187-20UG,BIM-RPC27187-100UG,BIM-RPC27187-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Serine protease 10
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TMPRSS2. Target Synonyms: Serine protease 10. Accession Number: O15393. Expression Region: 106~492aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 90.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 90.6kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
Target-Kategorie: TMPRSS2