Recombinant Mouse Phospholipase D3 (Pld3), Unconjugated

Artikelnummer: BIM-RPC27241
Artikelname: Recombinant Mouse Phospholipase D3 (Pld3), Unconjugated
Artikelnummer: BIM-RPC27241
Hersteller Artikelnummer: RPC27241
Alternativnummer: BIM-RPC27241-20UG,BIM-RPC27241-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3, Schwannoma-associated protein 9, SAM-9, Sam9, PLD 3)
Recombinant Mouse Phospholipase D3 (Pld3) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Pld3. Target Synonyms: Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3, Schwannoma-associated protein 9, SAM-9, Sam9, PLD 3). Accession Number: O35405. Expression Region: 1~488aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 58.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.2kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQA
Target-Kategorie: Pld3