Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated

Artikelnummer: BIM-RPC27243
Artikelname: Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated
Artikelnummer: BIM-RPC27243
Hersteller Artikelnummer: RPC27243
Alternativnummer: BIM-RPC27243-20UG,BIM-RPC27243-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Pre-GP-C
Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Lassa virus (strain GA391) (LASV). Target Name: GPC. Target Synonyms: Pre-GP-C. Accession Number: P17332. Expression Region: 259~490aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 29.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.7kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GTFTWTLSDSEGNETPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIRRLKTEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSRYWYLNHTSTGKTSLPRCWLISNGSYLNETKFSDDIEQQADNMITEMLQKEYIDRQGKTPLGLVDLFVFSTSFYLISIFLHLVKIPTHRHIVGKPCPKPHRLNHMGICSCGLYKQPGVPVRWKR
Target-Kategorie: GPC