Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT, Unconjugated, E. coli

Artikelnummer: BIM-RPC28281
Artikelname: Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT, Unconjugated, E. coli
Artikelnummer: BIM-RPC28281
Hersteller Artikelnummer: RPC28281
Alternativnummer: BIM-RPC28281-20UG,BIM-RPC28281-100UG,BIM-RPC28281-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Bj-alpha-IT
Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hottentotta judaicus(Black scorpion)(Buthotus judaicus). Target Name: Hottentotta judaicus Alpha-insect toxin BjaIT. Target Synonyms: Bj-alpha-IT. Accession Number: Q56TT9. Expression Region: 20~83aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 14.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR
Target-Kategorie: Hottentotta judaicus Alpha-insect toxin BjaIT