Recombinant Bovine Myotrophin (MTPN), Unconjugated, Yeast

Artikelnummer: BIM-RPC28336
Artikelname: Recombinant Bovine Myotrophin (MTPN), Unconjugated, Yeast
Artikelnummer: BIM-RPC28336
Hersteller Artikelnummer: RPC28336
Alternativnummer: BIM-RPC28336-20UG,BIM-RPC28336-100UG,BIM-RPC28336-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: MTPN, Myotrophin
Recombinant Bovine Myotrophin (MTPN) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: MTPN. Target Synonyms: MTPN, Myotrophin. Accession Number: Q3T0F7. Expression Region: 2~118aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 15.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.2kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Target-Kategorie: MTPN