Recombinant Human Proteoglycan 4 (PRG4), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC28337
Artikelname: Recombinant Human Proteoglycan 4 (PRG4), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC28337
Hersteller Artikelnummer: RPC28337
Alternativnummer: BIM-RPC28337-20UG,BIM-RPC28337-100UG,BIM-RPC28337-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Lubricin (Megakaryocyte-stimulating factor, Superficial zone proteoglycan, MSF, SZP)
Recombinant Human Proteoglycan 4 (PRG4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Prg4. Target Synonyms: Lubricin (Megakaryocyte-stimulating factor, Superficial zone proteoglycan, MSF, SZP). Accession Number: Q92954. Expression Region: 25~156aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
Target-Kategorie: Prg4