Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64), Unconjugated, Yeast

Artikelnummer: BIM-RPC28339
Artikelname: Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64), Unconjugated, Yeast
Artikelnummer: BIM-RPC28339
Hersteller Artikelnummer: RPC28339
Alternativnummer: BIM-RPC28339-20UG,BIM-RPC28339-100UG,BIM-RPC28339-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Antigen MPT64
Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64 (mpt64) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Target Name: mpt64. Target Synonyms: Antigen MPT64. Accession Number: P9WIN9. Expression Region: 24~228aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Target-Kategorie: mpt64