Recombinant Human Interleukin-7 (IL7) , Active Protein, Unconjugated, E. coli

Artikelnummer: BIM-RPC29194
Artikelname: Recombinant Human Interleukin-7 (IL7) , Active Protein, Unconjugated, E. coli
Artikelnummer: BIM-RPC29194
Hersteller Artikelnummer: RPC29194
Alternativnummer: BIM-RPC29194-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Interleukin-7, IL-7, IL7
Accession Number: P13232; IL7. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 26-177aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human Interleukin-7 (IL7) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 17.5kDa
Tag: Tag-Free
Reinheit: >95% by SDS-PAGE
Sequenz: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Target-Kategorie: Interleukin-7 (IL7)