Recombinant E. coli NAD-dependent protein deacylase (cobB), Unconjugated

Produktübersicht

• Artikelname: Recombinant E. coli NAD-dependent protein deacylase (cobB), Unconjugated
• Artikelnummer: BIM-RPC29596
• Hersteller Artikelnummer: RPC29596
• Alternativnummer: BIM-RPC29596-20UG,BIM-RPC29596-100UG,BIM-RPC29596-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: E. coli
• Konjugation: Unconjugated
• Alternative Synonym: Regulatory protein SIR2 homolog

Produktbeschreibung

Recombinant E. coli NAD-dependent protein deacylase (cobB) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: NAD-dependent protein deacylase (cobB) . Accession Number: P75960, cobB. Expression Region: 1-242aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 34.3kda. Target Synonyms: Regulatory protein SIR2 homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 34.3kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >95% by SDS-PAGE
• Sequenz: MEKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVATPEGFDRDPELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNIDNLHERAGNTNVIHMHGELLKVRCSQSGQVLDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALSMADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGNEFAEKYYGPASQVVPEFVEKLLKGLKAGSIA
• Target-Kategorie: NAD-dependent protein deacylase (cobB)