Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7), Unconjugated, E. coli
• Artikelnummer: BIM-RPC29750
• Hersteller Artikelnummer: RPC29750
• Alternativnummer: BIM-RPC29750-20UG,BIM-RPC29750-100UG,BIM-RPC29750-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: BTG1-binding factor 1, CCR4-associated factor 1, CAF-1, Caf1a

Produktbeschreibung

Accession Number: Q9UIV1; CNOT7. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-285aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Epigenetics, Nuclear Signaling. Shipping Condition: Ice packs. Short Description: Recombinant Human CCR4-NOT transcription complex subunit 7 (CNOT7) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 36.8kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAK
• Target-Kategorie: CCR4-NOT transcription complex subunit 7 (CNOT7)