Recombinant Daucus carota Phytosulfokine receptor 1 (PSKR), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC29757
Artikelname: Recombinant Daucus carota Phytosulfokine receptor 1 (PSKR), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC29757
Hersteller Artikelnummer: RPC29757
Alternativnummer: BIM-RPC29757-20UG,BIM-RPC29757-100UG,BIM-RPC29757-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: DcPSKR1, Phytosulfokine LRR receptor kinase 1
Accession Number: Q8LPB4; PSKR. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24-659aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Daucus carota Phytosulfokine receptor 1 (PSKR), partial is a purified Recombinant Protein
Molekulargewicht: 70.8kDa
Tag: C-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: SQNLTCNSNDLKALEGFMRGLESSIDGWKWNESSSFSSNCCDWVGISCKSSVSLGLDDVNESGRVVELELGRRKLSGKLSESVAKLDQLKVLNLTHNSLSGSIAASLLNLSNLEVLDLSSNDFSGLFPSLINLPSLRVLNVYENSFHGLIPASLCNNLPRIREIDLAMNYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLEL
Target-Kategorie: Phytosulfokine receptor 1 (PSKR)