Recombinant Human Desmoglein-2 (DSG2), partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human Desmoglein-2 (DSG2), partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC29764
• Hersteller Artikelnummer: RPC29764
• Alternativnummer: BIM-RPC29764-20UG,BIM-RPC29764-100UG,BIM-RPC29764-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Cadherin family member 5, HDGC, CDHF5

Produktbeschreibung

Accession Number: Q14126; DSG2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 50-609aa. Protein Length: partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Desmoglein-2 (DSG2), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 67.5kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: AWITAPVALREGEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADEIGS
• Target-Kategorie: Desmoglein-2 (DSG2)