Recombinant Human Calpastatin (CAST), Unconjugated, E. coli

Artikelnummer: BIM-RPC29769
Artikelname: Recombinant Human Calpastatin (CAST), Unconjugated, E. coli
Artikelnummer: BIM-RPC29769
Hersteller Artikelnummer: RPC29769
Alternativnummer: BIM-RPC29769-20UG,BIM-RPC29769-100UG,BIM-RPC29769-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Calpain inhibitor, Sperm BS-17 component
Accession Number: P20810; CAST. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-667aa. Protein Length: Full Length of isoform 4. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Neuroscience. Shipping Condition: Ice packs. Short Description: Recombinant Human Calpastatin (CAST) is a purified Recombinant Protein
Molekulargewicht: 75.9kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALS
Target-Kategorie: Calpastatin (CAST)