Recombinant Human Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2), Unconjugated, E. coli

Artikelnummer: BIM-RPC29791
Artikelname: Recombinant Human Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2), Unconjugated, E. coli
Artikelnummer: BIM-RPC29791
Hersteller Artikelnummer: RPC29791
Alternativnummer: BIM-RPC29791-20UG,BIM-RPC29791-100UG,BIM-RPC29791-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Eukaryotic translation initiation factor 2-alpha kinase 2
Accession Number: P19525; EIF2AK2. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 2-551aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Signal Transduction. Shipping Condition: Ice packs. Short Description: Recombinant Human Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2) is a purified Recombinant Protein
Molekulargewicht: 78kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: AGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKET
Target-Kategorie: Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2)