Recombinant Lake Victoria marburgvirus RNA-directed RNA polymerase L (L), partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Lake Victoria marburgvirus RNA-directed RNA polymerase L (L), partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC29901
• Hersteller Artikelnummer: RPC29901
• Alternativnummer: BIM-RPC29901-20UG,BIM-RPC29901-100UG,BIM-RPC29901-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Konjugation: Unconjugated
• Alternative Synonym: Protein L, Large structural protein, Replicase, Transcriptase, PRNTase, mRNA (guanine-N(7, G-N7-MTase, mRNA (nucleoside-2-O-, N1-2-O-MTase

Produktbeschreibung

Recombinant Lake Victoria marburgvirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lake Victoria marburgvirus (strain Popp-67) (MARV) (Marburg virus (strain West Germany/Popp/1967)). Target Name: RNA-directed RNA polymerase L (L) . Accession Number: P35262, L. Expression Region: 628-812aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 28.7kda. Target Synonyms: Protein L, Large structural protein, Replicase, Transcriptase, PRNTase, mRNA (guanine-N(7, G-N7-MTase, mRNA (nucleoside-2-O-, N1-2-O-MTase Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 28.7kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: RGASFVTDLEKYNLAFRYEFTRHFIDYCNRCYGVKNLFDWMHFLIPLCYMHVSDFYSPPHCVTEDNRNNPPDCANAYHYHLGGIEGLQQKLWTCISCAQITLVELKTKLKLKSSVMGDNQCITTLSLFPIDAPDDYQENEAELNAARVAVELAITTGYDGIFLKPEETFVHSGFIYFGKKQYLNG
• Target-Kategorie: RNA-directed RNA polymerase L (L)