Recombinant Human C-X-C chemokine receptor type 4 (CXCR4) -VLPs , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC29949
Artikelname: Recombinant Human C-X-C chemokine receptor type 4 (CXCR4) -VLPs , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC29949
Hersteller Artikelnummer: RPC29949
Alternativnummer: BIM-RPC29949-20UG,BIM-RPC29949-100UG,BIM-RPC29949-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CXC-R4, CXCR-4, FB22, Fusin, HM89, LCR1, Leukocyte-derived seven transmembrane domain receptor, LESTR, Lipopolysaccharide-associated protein 3, LAP-3, LPS-associated protein 3, NPYRL, Stromal cell-derived factor 1 receptor, SDF-1 receptor, CD antigen CD184
Recombinant Human C-X-C chemokine receptor type 4 (CXCR4) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein, Active Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens). Target Name: C-X-C chemokine receptor type 4 (CXCR4) -VLPs. Accession Number: P61073, CXCR4. Expression Region: 1-352aa. Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 41.5kda. Target Synonyms: CXC-R4, CXCR-4, FB22, Fusin, HM89, LCR1, Leukocyte-derived seven transmembrane domain receptor, LESTR, Lipopolysaccharide-associated protein 3, LAP-3, LPS-associated protein 3, NPYRL, Stromal cell-derived factor 1 receptor, SDF-1 receptor, CD antigen CD184 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.5kDa
Tag: C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)
Reinheit: The purity information is not available for VLPs proteins
Sequenz: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPY
Target-Kategorie: C-X-C chemokine receptor type 4 (CXCR4) -VLPs