Recombinant Escherichia phage T7 DNA helicase/primase, partial, Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Escherichia phage T7 DNA helicase/primase, partial, Unconjugated, E. coli
• Artikelnummer: BIM-RPC29967
• Hersteller Artikelnummer: RPC29967
• Alternativnummer: BIM-RPC29967-20UG,BIM-RPC29967-100UG,BIM-RPC29967-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Konjugation: Unconjugated
• Alternative Synonym: Gene product 4 (Gp4)

Produktbeschreibung

Recombinant Escherichia phage T7 DNA helicase/primase, partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Escherichia phage T7 (Bacteriophage T7). Target Name: DNA helicase/primase. Accession Number: P03692, N/A. Expression Region: 151-548aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 51.3kda. Target Synonyms: Gene product 4 (Gp4) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 51.3kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: KKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRL
• Target-Kategorie: DNA helicase/primase