Recombinant Mouse Cis-aconitate decarboxylase (Acod1), Unconjugated, Virus

Produktübersicht

• Artikelname: Recombinant Mouse Cis-aconitate decarboxylase (Acod1), Unconjugated, Virus
• Artikelnummer: BIM-RPC29977
• Hersteller Artikelnummer: RPC29977
• Alternativnummer: BIM-RPC29977-20UG,BIM-RPC29977-100UG,BIM-RPC29977-1MG
• Hersteller: Biomatik Corporation
• Wirt: Virus
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: CAD, Aconitate decarboxylase, Aconitate decarboxylase 1, Cis-aconitic acid decarboxylase, Immune-responsive gene 1 protein

Produktbeschreibung

Recombinant Mouse Cis-aconitate decarboxylase (Acod1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Cis-aconitate decarboxylase (Acod1) . Accession Number: P54987, Acod1. Expression Region: 1-488aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 58.3kda. Target Synonyms: CAD, Aconitate decarboxylase, Aconitate decarboxylase 1, Cis-aconitic acid decarboxylase, Immune-responsive gene 1 protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Produkteigenschaften

• Molekulargewicht: 58.3kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >85% by SDS-PAGE
• Sequenz: MMLKSVTESFAGMIHGLKVNHLTDGIIRRSKRMILDSLGVGFLGTGTEVFHKVTQYSKIYSSNTSSTVWGRPDFRLPPTYAAFVNGVAVHSMDFDDTWHPATHPSGAVLPVLTALSEALPQIPKFSGLDLLLAFNVGIEVQGRLMHFSKEAKDIPKRFHPPSVVGTLGSAAAASKFLGLSLTKCREALAIAVSHAGAPIANAATQTKPLHIGNAAKHGMEATFLAMLGLQGNKQILDLGSGFGAFYANYSPEDLP
• Target-Kategorie: Cis-aconitate decarboxylase (Acod1)