Recombinant Mouse Metalloproteinase inhibitor 4 (Timp4), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Mouse Metalloproteinase inhibitor 4 (Timp4), Unconjugated, E. coli
• Artikelnummer: BIM-RPC30527
• Hersteller Artikelnummer: RPC30527
• Alternativnummer: BIM-RPC30527-20UG,BIM-RPC30527-100UG,BIM-RPC30527-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: Tissue inhibitor of metalloproteinases 4, TIMP-4

Produktbeschreibung

Accession Number: Q9JHB3; Timp4. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 30-224aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Mouse Metalloproteinase inhibitor 4 (Timp4) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 35.6kDa
• Tag: N-Terminal 6xHis-SUMO-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: CSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP
• Target-Kategorie: Metalloproteinase inhibitor 4 (Timp4)