Recombinant Human Probable serine carboxypeptidase CPVL (CPVL), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human Probable serine carboxypeptidase CPVL (CPVL), Unconjugated, E. coli
• Artikelnummer: BIM-RPC30531
• Hersteller Artikelnummer: RPC30531
• Alternativnummer: BIM-RPC30531-20UG,BIM-RPC30531-100UG,BIM-RPC30531-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: Carboxypeptidase, vitellogenic-likeVitellogenic carboxypeptidase-like protein, VCP-like protein, hVLP

Produktbeschreibung

Accession Number: Q9H3G5; CPVL. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 23-476aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cell Biology. Shipping Condition: Ice packs. Short Description: Recombinant Human Probable serine carboxypeptidase CPVL (CPVL) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 67.9kDa
• Tag: N-Terminal 6xHis-SUMO-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: LFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIE
• Target-Kategorie: Probable serine carboxypeptidase CPVL (CPVL)