Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA), Unconjugated, E. coli

Artikelnummer: BIM-RPC30533
Artikelname: Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA), Unconjugated, E. coli
Artikelnummer: BIM-RPC30533
Hersteller Artikelnummer: RPC30533
Alternativnummer: BIM-RPC30533-20UG,BIM-RPC30533-100UG,BIM-RPC30533-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Accession Number: Q9I3F3; tusA. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-79aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Pseudomonas aeruginosa Sulfurtransferase TusA homolog (tusA) is a purified Recombinant Protein
Molekulargewicht: 21.8kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MTHSVDAILDATGLNCPEPVMMLHNKVRDLAPGGLLKVIATDPSTRRDIPKFCVFLGHELVEQQEEAGTYLYWIRKKAD
Target-Kategorie: Sulfurtransferase TusA homolog (tusA)