Recombinant Human Spermatogenesis-defective protein 39 homolog (SPE39), Unconjugated, E. coli

Artikelnummer: BIM-RPC30535
Artikelname: Recombinant Human Spermatogenesis-defective protein 39 homolog (SPE39), Unconjugated, E. coli
Artikelnummer: BIM-RPC30535
Hersteller Artikelnummer: RPC30535
Alternativnummer: BIM-RPC30535-20UG,BIM-RPC30535-100UG,BIM-RPC30535-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: VPS33B-interacting protein in apical-basolateral polarity regulatorVPS33B-interacting protein in polarity and apical restriction
Accession Number: Q9H9C1; VIPAS39. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1-493aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Human Spermatogenesis-defective protein 39 homolog (SPE39) is a purified Recombinant Protein
Molekulargewicht: 73.0kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELA
Target-Kategorie: Spermatogenesis-defective protein 39 homolog (SPE39)