Recombinant Human Interferon kappa (IFNK), Unconjugated, E. coli

Produktübersicht

• Artikelname: Recombinant Human Interferon kappa (IFNK), Unconjugated, E. coli
• Artikelnummer: BIM-RPC30537
• Hersteller Artikelnummer: RPC30537
• Alternativnummer: BIM-RPC30537-20UG,BIM-RPC30537-100UG,BIM-RPC30537-1MG
• Hersteller: Biomatik Corporation
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: IFN-kappa

Produktbeschreibung

Accession Number: Q9P0W0; IFNK. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 28-207aa. Protein Length: Full Length of Mature Protein. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Immunology. Shipping Condition: Ice packs. Short Description: Recombinant Human Interferon kappa (IFNK) is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 29.6kDa
• Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
• Target-Kategorie: Interferon kappa (IFNK)