Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC30544
Artikelname: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC30544
Hersteller Artikelnummer: RPC30544
Alternativnummer: BIM-RPC30544-20UG,BIM-RPC30544-100UG,BIM-RPC30544-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Non-specific crossreacting antigen, Normal cross-reacting antigen, CD66c
Accession Number: P40199; CEACAM6. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 35-320aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Tags & Cell Markers. Shipping Condition: Ice packs. Short Description: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 32.6kDa
Tag: C-Terminal 10xHis-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPN
Target-Kategorie: Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6)