Recombinant Human Dipeptidase 3 (DPEP3), partial , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC30546
Artikelname: Recombinant Human Dipeptidase 3 (DPEP3), partial , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC30546
Hersteller Artikelnummer: RPC30546
Alternativnummer: BIM-RPC30546-20UG,BIM-RPC30546-100UG,BIM-RPC30546-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: UNQ834, PRO1772
Accession Number: Q9H4B8; DPEP3. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 36-463aa. Protein Length: Partial. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Dipeptidase 3 (DPEP3), partial , Active Protein is a purified Active Recombinant Protein
Molekulargewicht: 48.3kDa
Tag: C-Terminal 10xHis-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFS
Target-Kategorie: Dipeptidase 3 (DPEP3)