Recombinant Macaca mulatta Microtubule-associated protein tau (MAPT) , Active Protein, Unconjugated, Mammal

Produktübersicht

• Artikelname: Recombinant Macaca mulatta Microtubule-associated protein tau (MAPT) , Active Protein, Unconjugated, Mammal
• Artikelnummer: BIM-RPC30552
• Hersteller Artikelnummer: RPC30552
• Alternativnummer: BIM-RPC30552-20UG,BIM-RPC30552-100UG,BIM-RPC30552-1MG
• Hersteller: Biomatik Corporation
• Wirt: Mammal
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Konjugation: Unconjugated
• Alternative Synonym: Neurofibrillary tangle protein, Paired helical filament-tau, PHF-tau

Produktbeschreibung

Accession Number: P57786; MAPT. Activity: Biologically Active. Endotoxin Level: <1.0 EU/ug, by LAL method. Expiration: 12 months. Expression Region: 2-459aa. Protein Length: Full Length of Mature Protein. Protein Type: Active Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Neuroscience. Shipping Condition: Ice packs. Short Description: Recombinant Macaca mulatta Microtubule-associated protein tau (MAPT) , Active Protein is a purified Active Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 50.6kDa
• Tag: N-Terminal 10xHis-Tagged
• Reinheit: >95% by SDS-PAGE
• Sequenz: AEPRQEFDVMEDHAGTYGLGDRKDQEGYTMLQDQEGDTDAGLKESPLQTPAEDGSEELGSETSDAKSTPTAEDVTAPLVDERAPGEQAAAQPHMEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSATKQVQRKPPPAEPTSERGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPAREPKKVAVVRTPPKSPS
• Target-Kategorie: Microtubule-associated protein tau (MAPT)