Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1 (RpII215), partial, Unconjugated, Yeast

Produktübersicht

• Artikelname: Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1 (RpII215), partial, Unconjugated, Yeast
• Artikelnummer: BIM-RPC30568
• Hersteller Artikelnummer: RPC30568
• Alternativnummer: BIM-RPC30568-20UG,BIM-RPC30568-100UG,BIM-RPC30568-1MG
• Hersteller: Biomatik Corporation
• Wirt: Yeast
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Drosophila
• Konjugation: Unconjugated
• Alternative Synonym: DNA-directed RNA polymerase III largest subunit

Produktbeschreibung

Accession Number: P04052; RpII215. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1579-1881aa. Protein Length: Partial. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Others. Shipping Condition: Ice packs. Short Description: Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1 (RpII215), partial is a purified Recombinant Protein

Produkteigenschaften

• Molekulargewicht: 33.6kDa
• Tag: N-Terminal 6xHis-Tagged
• Reinheit: >90% by SDS-PAGE
• Sequenz: YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIY
• Target-Kategorie: DNA-directed RNA polymerase II subunit RPB1 (RpII215)